Learn from the Best

Lunge Pathways are created using millions of documents and information sources.

Climate%20Crisis%20Action%20Plan

auto-generated 22-Apr-2021

SOLVING THE CLIMATE CRISIS The Congressional Action Plan for a Clean Energy Economy and a Healthy, Resilient, and Just America Majority Sta(cid:126) Report SOLVING THE CLIMATE CRISIS The Congressional Action Plan for a Clean Energy Economy and a Healthy, Resilient, and Just America SELECT COMMITTEE ON THE CLIMATE CRISIS MAJORITY STAFF REPORT 116TH CONGRESS PREPARED BY MAJORITY COMMITTEE STAFF PURSUANT TO H.RES.6 DEMOCRATIC MEMBERS OF THE SELECT COMMITTEE Rep. Kathy Castor (D-FL), Chair Rep. Ben

make new and existing   investments in new generation   crisis in a resolution   assistance from the department   program so that tva   decarbonization of the economy   benefits of the renewable   benefits of zero emission   utilities about the risks  

Sources: IHS Markit


Pathway Classification

This section lists the Pathway type, Priority/ function areas, Sectors/ fields of life and People/ roles for the pathway.

Priority/ Function Areas:   Business & Industrial |
Sectors/ Fields of Life:   Economy-wide |

Pathway Information

This section lists the Categories, Goals, Measures and Actions included in the pathway.

Profiles:   the report   the economics   al insights   another issue   the coalition   any standard   this impacts   the service   the policies   an markets   a product   a investment   each region   this lines   a administration   the costs   an states   the print   staff recommendations   the treatment   a element   it law   cpuc background   the farm   this rulemaking   a tank   an scientists   the provisions   all humans   a grid   this problem   the program   a backbone   a goal   usa report   the action   a statement   this ideas   an members   the nexus   ferc order   the system   the order   this provision   a president   the improvements   the majority   every initiative   the reforms   administration nuclear   congress legislation   the analysts   the potential   any framework   a floor   california cities   network mission   it reliability   this markets   the analysis   this action   a challenge   indopacific failure   agency frameworkagreementcleanemission   all states   e section   a source   the grid   a deadline   the communities   that vehicle   the administration   the threat   the rule   the budget   each installation   the projects   the goals   a relationship   the workers   a credit   heat171 heat   the world   the vehicles   each state   the sector   a program   a utility   twentysix states   the legislation   committee draft   the recommendations   we world   the environment   the option   this review   the industry   ev chargers   america farmers   this transitions   this credits   this section   wwwgaogovhighrisklimiting_federal_government_fiscal_exposurewhy_did_study panel   u territories   a partner   the benefits   the resource   the plan   the pace   the regions   the resilience   a line   this law   the blackout   ferc consideration   the commission   the threats   this transformers   whose term   the goal   the utilities   ferc espouses   the imposition   the city   the requirement   its meetings   all sectors   all vehicles   this legislation   this contracts   this funds   the standard   april panel   the committee   the investment   this bill   the thing   the pandemic   the ability   a community   the network   this problems   the challenge   that deployment   the draft   the entities   this benefits   the requirements   the percentage   the policy   the interconnection   this changes   the military   a plan   this approach   congress committee   february page   development block   earth levels   the ptc   each part   the house   a commitment   a resource   this program   the assessment   july office   the credit   c sections   this decrease   all facilities   the effects   the state   which projects   the operation   the office   all communities   each automaker   the creativity   we faith   that level   a rock   the farms   this projects   gramlich impacts   releaseshousedemocratspushbackagainstproposedchangestonuclearregulatory office   the labs   house committee   the economy   that responsibility   research141 recommendation   this transformation   the subset   the issue   a percentage   emissions217 eia   each person   the production   transformation74 decarbonization   the number   the bill   a payment   the intent   a automaker   a economy   the rtoiso   the source   the mandate   vi definitions   the academies   mckinsey company   a tsunami   the nrc   this processes   the level   the statement   the climate   the tribe   the size   a strategy   the credits   this provisions   a authority   eia projects   a report   any policy   this deadlines   lng infrastructure   the nation   the standards   a standard   this failures   a technologies   the reactor   the emitter   the investments   the branch   the lines   the blocks   this technologies   what products   a center   its communities   the story   it goal   hub86 members   a system   diffenbaugh reduction   this situations   this amount   the section   any delay   the value   the prices   the panel   no project   dec panel   both bills   this policy   the infrastructure   its components   response management   the process   the resolution   rto staff   america pledge   ipcc scientists   the definition   the formula   the one   this report   the planet   the staff   transformers182 support   the earth   the vehicle   the research   the needs   the buildout   the bills   any policies   the public   every recommendation   committee report   the emissions   this goals   the responsibility   a individuals   the impacts   the landscape   rd loan   a web   a trend   the government   the force   america fleet   this notions   no one   a item   the president   the foundation   appropriate188 solutions   the operator   whose input   this office   the crisis   an companies   all recommendations   the board   the country
Goals:   preview policy recommendations   build fairer code   remove slow roadblocks   enact clean standard   meet domestic goal   aim open j   increase energy generation   avoid build need   fulfill energy policies   integrate energy resources   require vast deployment   achieve clean generation   strengthen climate policy   build direct lines   create tax credits   help lines site   cause drier conditions   address climate crisis   increase cover glaciers   provide including benefits   cover rising number   reduce increase capacity   address risks flooding   promote energy generation   release discussion draft   offer unique opportunity   update design basis   designate interest corridors   resolve interconnection backlogs   outline climate plan   improve energy efficiency   award adopt grants   bear most responsibility   light religious response   provide assistance incentives   ensure domestic manufacturing   lead pfas amendment   pay consistent wages   meet labor standards   provide invest funding   facilitate decarbonized supply   strengthen affordable housing   reflect available science   offer moving act   prepare telecommunications networks   build fair congress   make infrastructure choices   choose lower value   build ensure initiatives   generate health benefits   generate energy onsite   produce goodpaying jobs   establish demonstration program   achieve develop emissions   establish crosscutting program   reclaim pose wells   develop voluntary protocol   construct transmission lines   build resilient economy   make public lands   introduce investment act   decarbonize electricity sector   set offer prices   reduce posed risks   conduct break rulemaking   attain emissions reductions   eliminate tax breaks   invent innovation policy   reduce soft costs   create highquality jobs   focus regulatory attention   require new construction   reduce expand protections   face higher probability   establish government force   calculate intergenerational costs   introduce public engagement   provide technical resources   spur domestic congress   govern power markets   provide ethical dimension   reform mapping programs   inform reliability standards   capture full potential   avert worst consequences   introduce providing opportunities   face structural barriers   reduce risks costs   limit regulate ability   rebuild transportation infrastructure   facilitate energy integration   expand modernize maintain   adopt require designs   create workforce program   introduce solar expansion   develop power systems   discuss numerous challenges   cut environmental justice   outweigh potential costs   ensure level field   degrade quality air   establish coordinated plan   require reach investments   prepare plug leaks   inform maintenance operations   leverage reconstruction investments   improve safety operations   fix transportation act   hold official hearings   review sector groups   generate lasts waste   include reporting provision   replace utility poles   achieve urgent reductions   introduce solar act   require high confidence   negotiate working conditions   determine appropriate value   buy directs requirements   establish voluntary program   wave species loss   set emissions standards   improve public health   reauthorize sustainability program   establish purchase goals   support food systems   improve vehicle efficiency   cover including technologies   announce historic agreement   develop help tools   improve climate benefits   align tax code   introduce smart act   follow majority staff   leaf vulnerable plants   introduce climate resiliency   reduce need impacts   build fueling emission   expand middle class   implement inclusive process   30c refueling credit   provide groups community   update market rules   extend creating expanding   set electricity sector   spur domestic manufacturing   require same commitment   propose weaken rule   develop energy efficiency   require scientific assistance   finalize unified standards   create climate views   charge refueling credit   make needed changes   deploy risk information   draft interconnection study   inspect energy resources   achieve climate pollution   negotiate voluntary agreementinprinciple   wash roads bridges   preempt energy initiatives   identify feasible alternatives   offer solar programs   affect geographic seasonality   set ambitious goal   use focused strategies   facilitate resilient supply   conduct determine analysis   seek including renewals   demonstrate zeroemission technologies   generate cost savings   exceed highest average   assist departments communities   succeed technical issue   develop narrow proposals   improve reliability committees   buy prevailing requirements   develop exporting deploying   increase energy production   use building materials   require government suppliers   provide agency ferc   improve technologies recommendation   establish water efficiency   unveil solar panels   pas committee draft   provide comprehensive set   direct management agencies   include property generators   create power markets   reinvigorate energy sector   help press release   allocate governments tribes   pursue including policies   avoid worst impacts   introduce renewable energy   experience heat waves   reduce sequestration enhance   reduce fiscal exposure   advance energy resilience   slow development permitting   direct agency ferc   satisfy specified requirements   incentivize energy development   harden physical infrastructure   develop next generation   support ensure approaches   introduce economy act   reflect need services   direct administrations tva   issue executive order   degrade flooding disease   build economy pillar   develop consistent transmission   implement raised rules   improve tools technologies   eliminate pollution waste   understand interconnected system   develop development program   enforce standards committee   coordinate improve operations174   pass illustrate bills   establish voluntary standard   affect environmental impacts   create energy standard   achieve needed mindset   site deep repository   restore carbon systems   maintain robust program   set price cap   build healthier hr   navigate oftenbroken system   correct policy failures   strengthen environmental justice   plan essential element   create new generation   develop put plan   establish low standard   address disrupt ways   meet certain percentage   use aid funds   provide additional recommendations   introduce leading infrastructure   develop permanent solution   project discussion draft   look fourth assessment   extend tax credits   upgrade transmission facilities   build transmission lines   create new initiative   mitigate unintended impacts   require new standards   provide services electricity   introduce reliable investment   introduce advanced act   deliver dioxide reductions   introduce energy certainty   recommit global initiative   connect interconnections building   fund infrastructure priorities   offer require recommendations   reduce insurance risks   replace infrastructure collaborate   achieve emissions reductions   restore full protections   involve transaction costs   aging average reactor   establish reduce program   achieve outweigh benefits   develop renewable zones   create financing programs   make new buildings   introduce green energy   leverage procurement policies   establish clean standard   transform public lands   undermine clean leadership   address mental effects   adopt vehicle emissions   boost environmental justice   continue help vows   exercise siting authority   develop infrastructure strategy   relieve economic crisis   use produced electricity   spur new generation   meet facilitating goal   introduce wind act   offer convenient alternatives   establish evaluation measurement   use energy policy   include authorizing provision   create resilient finance   demonstrate tools technologies   reflect latest information   recommend broad suite   develop using systems   decarbonize sector storage   retain existing authority   express led concern   give oversight authority   extend safe deadlines   set detect standards   respect forms nature   address localized concerns   threaten tribal committee   flood worsen risk   play expanded role   introduce incentive act   receive tax credit   produce uses energy   support local departments   hit vehicle cap   encourage states cities   implement other rules   ensure presentation resilience   may unemployment analysis   offset remaining use   restore natural spaces   exceed special report   facilitate modeling action   create crosscutting program   develop tools technologies   require power plants   develop robust set   maintain responsiveness congress   facilitate flexible grid   solve climate crisis   increase relative efficiency   use much 25   deploy limit pathways   adopt address measures   incorporate resilience standards   establish competitive fund   methane climate pollutant   achieve highest rating   create storage itc   solve congressional plan   select public analysts   reflect made amendments   tap authority congress   facilitate action action   ensure including areas   wait dioxide concentrations   trade energy credits   apply model agencies   implement broad portfolio   meet electricity needs   enable administrations tva   mitigate bid offer   amend power act   satisfy scientific imperative   moderate expected increase   need robust system   follow maintain practices   set emission standards   trigger siting authority   improve cost calculations   achieve average rate   reauthorize research development   eliminate government subsidies   satisfy domestic demand   develop risk information   achieve reductions congress   create assistance program   create voluntary program   help power plants   smooth electricity demand   transmit large amounts   prevent premature deaths   finance solar project   provide tax relief   leave notable gap   introduce expanding access   develop using projects   take different approach   withstand unavoidable impacts   block discrimination policies   evaluate climaterelated risks   release final report   include imposes costs   withdraw states cities   incentivize local investments   build cleaner sector   site transmission lines   develop pilot program   provide aid assistance   offer programs section   establish standards committees   modernize power markets   launch economic sectors   encourage deployment134 section   maintain strong recommendation   treat tax credit   understand potential impacts   seek equity partners   develop comprehensive program   minimize risks recommendation   increase office funding   present replace opportunity   build modern grid   require electricity providers   introduce community act   leave exposed communities   set pollution standards   use planning models   offer individuals businesses   reach clean electricity   incentivize ranchers farmers   meet weighed goals   encourage cost allocation   achieve climate goals   make meet commitment   accelerate electricity future   establish loan program   build drive innovation   promulgate emissions standards   mitigate regional consequences   build fairer economy   deploy renewable energy   withstand climate impacts   establish strategic reserve   boost economic development   generate remains waste   build stronger economy   divide post cities   conduct necessary analysis   conduct increase rulemaking   provide grants loans   solve crisis jobs   provide assistance grants   provide direct option   procure needed services   felt health costs   conduct economic analysis   establish competitive program   emphasize savings benefits   review governing rules   asses true value   establish technology facilities   expand energy growth   sustain forces platforms   analyze myriad opportunities   survive climate crisis   improve market governance   provide cooling heating   nonprofit cooperatives ways   restore confront risks   avoid estimated deaths   use created funds   strengthen democratic institutions   improve assess ability   describe reduction goals   coordinate policy toplines   offer limiting gao19157sp   protect restore conserve   introduce discussion draft   develop zeroemission technologies   reflect end concerns   provide ancillary services   create resilient america   require public investment   protect strengthen science   bear much trillion   set energy outlook   survive outages insider   provide help incentives   asses technological complexities   require setting legislation   extend tax credit   create bipartisan committee   distribute energy electrification   receive state governments   borrow amendments authorities   represent manufacturing infrastructure   deploy energy technologies   generate much 80   achieve netzeroemissions sector   lead global charge   apply finance approaches   develop economic opportunities   inform solution providers   build durable economy   ensure exposed industries   address infrastructure challenges   identify environmental benefits   protect energy infrastructure   establish governing rules   solve stronger buildings   trigger siting recommendation   integrate battery resources   meet electricity demand   develop transmission facilities   integrate higher percentage   tackle climate crisis   oppose inspection cuts   bridge resilience gap   review stakeholder processes   disadvantage court decision   asses distributional impacts   prepare transportation systems   incarcerate individuals persons   evaluate multiple benefits   require actual reduction   play key role   upgrade businesses homes   establish report change   propose defray incentives   limit fuel leasing   direct select committee   lead global response   develop comprehensive strategy   confront climate crisis   build prosperous economy   offer propel opportunity   overcome health risks   lie solid foundation   amend diverse interests   finalize arguing rule   establish technical assistance   spur solar technology   overcome led failures   reveal infrastructure decisions   use natural resources   face given challenges   resolve technical issues   implement carbon price   require emissions reduction   achieve equity sustainability   play important role   strengthen sustainability program   equal demands scale   mitigate economics promise   enhance development supply   maximize emissions reductions   build healthier america   deliver urgent changes   use policy trading   face greatest impacts   build equitable economy   expand solar options   deliver highquality jobs   strengthen nation systems   target development assistance   require science agencies   issue threat assessment   complement variable output   set standards committee   promote resilience committee   expand energy efficiency   depopulate women communities   create provide program   create distributed board   asses safety performance   include software demand   enable emissions reductions   review decisionmaking processes   set nonbinding goal   travele interface lcfs   offer direct option   include cybersecurity plan   adopt expedited protocol   reduce carbon pollution   amend energy act   achieve conserve goal   review slowing barriers   reduce flood losses   facilitate consumer purchase   expand tax incentives   outline reduce policies   have take chance   quantify gas emissions   set nationwide goal   set wholesale rules   use existing authorities   promote driving projects   provide alternative method   accelerate energy innovation   create fair system   evaluate stakeholder processes   introduce integration act   clean duty vehicles   issue stating declaration   require free electricity   include establish territories   need funding attention   accelerate future https   conduct demonstration projects   require water supplies   decarbonize transportation sector   achieve carbon economy   drive clean deployment   jumpstart direct industry   achieve manufacturing goals   deploy large transformers   announce desalination hub   preserve adopt authority   shape energy future   neglect rural parts   strengthen health capabilities   introduce affordable evs   contain select recommendations   identify reduce opportunities   pose safety hazards   withstand works storms   introduce promoting act   exacerbate entrenched inequalities   build workforce capabilities   establish efficiency targets   avoid ensure outcomes   delay report release   alleviate cumulative impacts   harmonize planning processes   provide solar https   solve natural solutions   exclude operational sources   complement gas standards   employ expedite tools   support next generation   build cleaner economy   experience adverse health   expand research development   offer positive voice   felt rising costs   increase vehicle credit   heat including impacts   call proposed rule   identify show studies   ignore staff recommendations   exceed intergovernmental panel   develop wind energy   reject market rules   use same phase   build new line   build healthier economy   concentrate solar heating   create direct backbone   establish renewable standard   produce renewable energy   create supply chains   establish ready partnership   build transmission facility   build materials construction   conduct comprehensive review   reduce dioxide emissions   establish strengthen program   offer fix opportunity   set interim targets   modernize nation network   restore grasslands forests   harm curb pollution   examine generation queues   designate transmission corridors   come state policies   reinv continue savings   propose reliability standard   alleviate issue incentives   send expressing letter   help clean transition   include native villages   reauthorize development activities   permit transmission lines   include including participation   model emissions reductions   direct protection agency   establish standardize process   sign press release   accelerate disaster recovery   improve technologies committees   procure certain percentage   streamline line process   create power imbalance   develop response project   develop resilience standards   enhance global leadership   invalidate congestion study   address weather resilience   make sustained commitment   deliver health benefits   purchase used vehicle   fund revolving funds   analyze existing onshore   allocate program funds   offer tax credit   improve rebound ability   experience tangible benefits   provide tax benefits   create deployment program   introduce spent act   increase health emergencies   enhance related protections   ramp electricity generation   deploy boldest suite   implement comprehensive strategy   explore viable opportunities   introduce incentivizing act   afford acknowledge opportunity   approve subsequent renewal   build equitable policy   create priorities inefficiencies   wash ground airplanes   flood weather events   represent battery storage   conduct rigorous assessment   modernize program section   create climate crisis   exceed weight limits   face financial challenges   confront security threats   review diverse interests   lack energy policies   create stabilize future   threaten way ecosystems   protect most vulnerable   require reliability organization   augment technical capability   need transmit upgrade   expand store projects   increase several investments   create new program   use existing authority   establish workforce program   require emissions reductions   afford public opportunities   require regulatory commissions   exceed renewable energy   create climate resilient   amend independence act   meet climate goals   expand residential owners   storage energy standard   hit households farmers   create investment credit   fueling containing equipment   increase sector resilience   invest mitigation funds   spur energy technology   deploy energy resources   reduce disaster risks   adopt building codes   deny proposed project   use technology solutions   develop solar projects   deploy state ders   include holistic assessment   adopt growth strategies   prepare telecommunications network   impose transparency requirements   undergo energy retrofits   invest aid funds   integrate energy systems   establish climate service   offer address recommendations   translate fewer attacks   develop coordinated strategy   use tax credit   enact promote policies   achieve negative emissions17   address climate scientists   bend emissions curve   generate own electricity   include transmission owners   conduct imposes rulemaking   face including people   develop energy systems   implement broad suite   meet energy use   introduce green act   meet ambitious goals   build clean economy   lead opposing letter   pursue legislative solution   incentivize cities states   exacerbate racial injustices   outline clear goal   remedy unintended impacts   reach dioxide emissions   maintain environmental review   employ labor standards   lead transition efforts   include similar provision   deploy power technologies   accelerate full decarbonization   reduce required energy   provide strongest example   frustrate clean energy   introduce clean act   include burying coating   require electricity generation   introduce lowincome act   support state policies   ensure economic development   solve climate opportunities   enjoy set exemptions   accompany including policies   sell additional vehicles   establish distributed board   retool manufacturing facilities   create proposed mechanism   goodpaying fortify jobs   provide new credit   achieve pollution reductions   direct nuclear commission   update power act   provide livable climate   announce reduction goals   establish eliminate goal   deploy removal technology   establish interagency group   create select committee   quantify modeled innovation   operate plant presentation   develop renewable projects   address human crisis   cut oil infrastructure   stabilize needs climate67   facilitate buried development   demand comprehensive response   include mitigation grants   put communities people   strengthen integrity policies   provide defray grants   establish invest standards   develop allocation methodology   address distributional impacts   minimize regional impacts   obtain necessary permits   provide capital cash   reduce transmit ability   create clean program   level playing field   remove current doublecounting   fueling gasolinepowered vehicles   provide financial incentives   provide build roadmap   advance state policies   provide assistance committee   offer pay developers   build climate change   play active role   qualify energy systems   avert worst impacts   restore public lands   develop comprehensive plan   create local jobs   analyze fiscal impacts   lead next generation   maintain safety requirements   deliver electricity doe   host transmission capacity   develop policy recommendations   meet needs goal   create tax credit   leave related initiatives   establish task force   reduce smogforming soot   harness technological innovation   increase energy efficiency   purchase resources committee   asses including impacts   develop press release   diversify reduces generation   accept radioactive waste   bring detailing studies   adopt labor practices   lower energy use   present unique opportunity   take multiple members   site infrastructure congress   lay infrastructure pathways   assemble vehicles committee   make infrastructure investments   reel covid19 pandemic   create policy environment   maximize energy implementation   improve withstand ability   upgrade facilities plans   protect face species   create domestic jobs   help depend populations   finalize revoking rule   pas energy standard   decarbonize electricity transportation   achieve build goals   harness resources onshore   standards222 other states   organize technical conference   drive energy deployment   propose emergency preparedness   address moral obligation   export technology toplines   reauthorize energy efficiency   adopt management standards   seek move assistance   reduce important drivers   distribute vehicle equipment   attain improved environment   achieve gas emissions   bear climate change   have hear opportunity   reauthorize used program   develop inform scenarios   conduct require rulemaking   drive support compliance   complement support standards   identify policy path
Measures:   specific upgrades   mandatory closures   deep repository   energy initiatives   little funding   grand challenge   bulk system   stringent initiatives   renewable investment   nuclear plant   national performance   global pathways   great use   chronic underinvestment   global response   wholesale markets   high health   climaterelated opportunities   tax incentives   solar technology   multiple benefits   court decision   local authorities   smart use   agency ability   regional organizations   wide range   spin-dry storage   clean sector   federal preemption   exist rtos   public recommendation   specify requirements   senate companion   carbon sequestration   climate benefit   energy prices   natural systems   subsidize resources   federal action   exist reactors   correct failures   deep retrofits   existential crisis   aging plants   industrial systems   power systems   responsive hr   national withdrawal   additional technologies   interest program   increase demand   national goals   renewable ders   power technologies   arm forces   expose community   power markets   disposal solution   power transformers   improve resilience   stand committees   intergenerational costs   nuclear commission   extra warming   routine flaring   nuclear technologies   new projects   economic analysis   industrial efficiency   emergency preparedness   avoid damages   clean deployment   reduction goals   major suppliers   kavulla problems   new initiative   different approach   statutory authorities   urban areas   health benefits   necessary permits   public investment   businessasusual levels   electrical substations165   several strategies   weapon platforms   great impacts   remain vehicles   community initiative   federal property   new products   wholesale market   technologyneutral vehicle   regulatory policies   financial assistance   fair treatment   standard act   high education   research development   fast sheet   tribal utility   coral reefs   largescale reductions   property credit   correction electricitypolicycom   energy program   netnegative emissions   clean climate   upfront installation   medical bills   energy investing   emission reduction   renewable electrification   medium term   sustainable infrastructure   interim targets   infrastructure strategy   industrial process   federal governments   current workers   solar technologies   great attention   nexus crosscut   solution providers   use market   great opportunities   key part   public policies   infrastructure priorities   modele reductions   strict recommendation   direct technology   historic agreement   energyrelated emissions   disadvantage communities   great funding   ongoing responsiveness   mitigation funds   enact legislation   enhance efficiency   transmission operation   remote reconfiguration   dependent communities   democracy hr   vehicle equipment   power interruptions   resilience policy   nonessential work   public works   coordinate response   local benefits   fourth assessment   electricity demand   forego conclusions   netzero goals   similar provisions   current policies   social distancing   fund developers   global initiative   daunt task   move recommendation   federal procurement   pollution standards   different models   health system   equal access   offer prices   grind airplanes   more projects   aggressive reductions   policy analysis   actual reduction   tidal project   true value   energy economy   storage technology   economic resources   positive example   anthropogenic dioxide   extreme conditions   clean center   strategic equipment   high voltage   safe ground   resilience committee   solar vehicle   recovery centers   netzero generation   delicate equilibria   decarbonize grid   electric transmission   offshore wind   exist section   purchase incentives   clean development   local systems   energy property   national resiliency   environmental effects6   regional network   thereafter section   spend installation   ambitious reductions   national centers   plant presentation   digital divide   highquality jobs   process recommendation   predisaster funds   capture industry   safe longterm   solar credit   energy zones   fast reclosers   climate goals   full interconnections   designate entities   tribal climate   industrial facilities   insurance program   clean tax   comprehensive approach   economic inequalities   last years   early stages   public health   vehicle costs   disaster response   special report   renewable fuel   weather patterns   current doublecounting   nearterm goals   american manufacturing   economic inequality   generation queues   toxic pollution   family communities   national conference   general motors   former secretary   wholesale competition   comprehensive strategies   resilient energy   bad consequences   available science   federal resources   preindustrial levels   offshore technologies   insurance discounts   down line   historic emitter   grant program   vehicle adoption   financial purchase   necessary limitations   renewable zones   distribute program   local governments   electricity rates   tax liability   hybrid lists   key pillars   climate service   strict standards   technology committees   marry couples   strategic action   electric power   rdd strategy   wage requirements   tax partners   current backbone   american requirements   industrial emissions   growth strategies   federal experts   lengthy delays   unmitigated pricing   lead infrastructure   future outages   comprehensive program   change policy   transaction costs   equivalent dioxide   bold suite   residential solar   tribal leaders   onbill programs   great recession   regulatory attention   wooden poles   western half   emission standards   independent installation   few years   robust development   strong defense   transparency inclusion   electric vehicles   jurisdictional rate   innovative approaches   local communities   rural cooperatives   unique opportunity   jewish climate   governance processes   competitive grants   lowincome owners   additional resources   new development   good risks   available center   unfair competition   most areas   threat assessment   consistent funding   appropriate recommendation   new line   relevant activities   telecommunication networks   federal climate   veteran women   several areas   purpa regulations   revolve fund   southeast recommendation   societal racism71   food waste   electric grid181   federal officials   nuclear energy   full protections   new credits   range expansion   electrical equipment   easy solutions   marine centers   local innovation   net capacity   energy systems   federal loan   environmental quality   nonprofit organizations   clean companies   federal ethics   consumer interests   tax benefits   average rate   key strategy   unintended impacts   federal buildings   economywide goal   just rates   clean discussion   equitable access   interior block   global gas   sector analysts   costeffective investments   bid offer   dioxide removal   small number   solar generation   climate scientists   large amounts   lightduty vehicles   rotational grazing   bad impacts   wireless networks   challenge task   spend fuel   effective planning   latter half   report outages   economywide reductions   local jobs   federal standard   event loss   investment credit   unique challenges   energyintensive processes   doe offices   asymmetric risk   national standards   wildfire toplines   new environment   common home   expose frontline   incentive payments   indian law   annual benefits   exist plants   secure jobs   local investments   federal innovation   finance approaches   national benefits   require generators   domestic goals   dod locations   humanitarian response   national administration   serious challenges   safe operations   distribute installers   indigenous peoples   federal programs   many legislation   traditional financing   certain requirements   tool technologies   infrastructure gap   press release   update hazards   revolve funds   national importance   disaster recovery   democratic members   nondiscriminatory access   sltt planning   edge act   federal dissent   infrastructure committees   demonstration initiative   change climate   meaningful opportunity   large power   wildfire risk   clean generation   permanent repository   great savings   crisis opportunities   urgent reductions   political policy   electricity transportation   technical conference   corridor program   inspection program   rtoiso regions   solar project   federal strategies   irreplaceable parks   spend https   new infrastructure   improve planning   reactor safety   easy way   minimum ferc   clean leadership   valuable sinks   expand capacity   direct committee   prioritization act   outage insider   administration fish   household farmers   great participation   environmental justice   past failures   clean lessons   tactical systems   exist generators   fuel economy   consistent transmission   foundational studies   license renewal   highrenewable future   assistance funds   cost savings   intense hurricanes   water efficiency   renewable recommendation   own agency   additional years   ambitious policies   similar questions   expand access   low costs   full ways   rapid deployment   virtuous cycles   vehicle electrification   action action   federal standards221   qualify generators   vehicle emissions   democratic senators   equal credit   innovative strategies   federal economy   new risks   solar panels   global temperature   large user   expand protections   justice communities   reliability standards   onfarm efficiency   federal engagement   demographic factors   western interconnection   federal research   environmental law   inclusive committees   federal credit   livable climate   congressional office   conventional coal   electric bills   third party   security operations   late information   nuclear reactors   tobuild protocol   develop states   work families   use vehicle   potential threats   distribute recommendation   exist conduits   average reactor   tax credits   tree canopy   infrastructure challenges   flood events   unique services   local residents   tribal communities   small property   comprehensive strategy   distributional impacts   impacts8 program   high rating   global surveillance   structural barriers   legislative policy   recent years   exist processes   costshare requirements   minimum damage   hot year   work conditions   safe deadlines   electric highway   use212 officials   project developers   direct spending   underlie trends   solar gridscale   isolate neighborhoods   force platforms   original basis   crisis plan   evaluation measurement   waste repository   carbonintensive infrastructure   community needs   renewable systems   consistent wages   clean cars   private landowners   backstop authority   additional reductions   embed climate   safe harbor   review requirements   government tribes   additional way   resilient supply   fair terms   new programs   health effects   exist grid   individual supply   domestic facilities   native grasslands   public transit   develop technologies   distribute board   carbon sink   new alliance   incumbent technologies   potential hazards   energywater support   goodpaying jobs   numerous recommendations   joint hearing   moral issue   additional vehicles   ambitious committee   major cities   extreme impacts   home program   largescale storage   aggressive research   rapid transition   more authority   business opportunities   development demonstration   new beginning   economic vitality   transmission plan   late use   quality disease   resilient action   wild landscapes   scientific imperative   climate benefits   high hazard   broad range   national bank   relative efficiency   silver bullet   see appendix   transportation systems   relate spending   federal leadership   current rules   technological one   community resilience   great resilience   national climate   locate facilities   les pollution   les traffic   high levels   continental shelf   dual taxation   robust science   partisan think   regulatory commissions   american nerc   more manufacturing   lowincome communities   significant debt   grid components   additional electricity   sector storage   physical impacts   central feature   high section   robust set   forward act   build block   new substations   european deal   grow energy   successful toplines   commercial buildings   strict committee   future alliance   important role   circular economy   heavyduty trucks   achievable level   national targets   robust system   high areas   smart transportation   early technologies   liquefy e85   environmental information   conservation investments   level field   grid resilience   subsequent years   new leasing   alternative center   blue systems   ready access   local capabilities   liquid fuels   regional transmission   energy reliability   wholesale electricity   naturebased strategies   climate solutions   federal standards   prevail wages   carbon pollution   government suppliers   gross income   ambitious path   temporary reduction   great electrification   billiondollar events   regional initiatives   monetize benefits   regenerative fuel   light reactors   concern scientists   executive order   consumer demand   right direction   lowcarbon economy   task force   operational project   city states   soft costs   heavy precipitation   new construction   federal insurance   widespread providers   plan processes   fuelcell vehicles   fall value   energy production   inter planning   local experts   local funds   confidential recommendation   long term   medical needs   incomebased credit   local partners   exist system   energy growth   multinational companies   clean standards   offshore section   decommission reactors   loweremission materials   extreme resilience   future benefits   nuclear licensees   dioxide reductions   fair code   direct backbone   technical barriers   grow seasons   utility consumers   rural affairs   majority staff   renewable battery   gasolinepowered vehicles   build materials   legislative solutions   national stewardship   confront risks   offshore plan   zeroemission technologies   pollution reductions   essential element   nuclear reactor   move act   work capital   renewable sources   national inspection   electricity needs   maritime markets   netzero implementation   dodwide goals   third cause   independent operators   matter pollution   likely households   companybycompany citybycity   great deployment   permanent solution   more research   federal management   solar initiatives   longterm agreement   federal contracts   offshore facilities   renewable portfolio   electricity costs   weather resilience   new buildings   project effects   current generations   power losses   net sink   offshore committee   carbon dioxide   agricultural emissions   direct payment   industrial sectors   relate initiatives   clean research   electric reliability   nearby section   electric standards   flood insurance   financial risks   strong support   new innovations   marine monuments   geopolitical threats   federal facilities   yearoveryear reductions   only facility   distribute energy   cbo s   transmission lines   physical grid   public trust   technical capability   high plugin   retail providers   emission curve   remain use   increase center   technology toplines   meaningful involvement   extreme insecurity   consumer choice   offshore energy   fuel standard   energy infrastructure   play field   environmental communities   grid function   low resources   inclusive economy   vehicle standard   clean vehicles   wwwepagovsustainablewater infrastructureenergyefficiencywaterutilities   overlap laws   crisis scientists   first part   fund support   designate corridors   hvdc lines   electric vehicle   total electricity   advance manufacturers   billiondollar weather   urgent changes   automate systems   electric distribution   core institutions   geographic seasonality   relate agencies   market governance   costly impacts   orphane wells   underrepresented groups   carbonfree electricity   economic system   civilian reactors   government subsidies   existential threat   clean backlogs   voluntary standard   lowercost solution   overall energy   equitable policy   strong communities   exist authority   climaterelated risks   internal migration   comprehensive plan   spin-dry casks   new entrants   biodiversity crisis   exist literature   public opportunities   committee members   federal requirements   exist levels   nonwires solutions   down lines   solar tariffs   unnecessary breaks   grant programs   commercial application   carbonfree resources   clean energy   clean economy   many measures   reliable access   economic activity   daily exposure   extreme weather   natural spaces   resilient installations   last decade   netzero energy   local leaders   federal assistance   applicable rules   additional corridors   minimum standards   stakeholder process   middle class   continue neglect   state initiatives   key end   domestic manufacturing   such needs   equitable economy   carbon systems   voluntary certifications   significant cost   plan systems   advance technology   exist inequities   official hearings   renewable technologies   large transformers   incumbent generators   applicable standards   global emissions   significant benefits   advance alliance   elect officials   unify response   convenient alternatives   wholesale block   equipment reserves   new technologies   commercial reactor   military officials   offshore leasing   fair economy   front lines   manage risks   inclusive process   full set   electricity bills   fire risks   oceanbased address   manufacture transformation   myriad opportunities   specify period   publicprivate partnerships   people communities   deep decarbonization   original cosponsors   low members   build codes   certain amount   major automakers   devastate consequences   secondlargest source   large companies   finance programs   system interruption   solar https   high average   cumulative impacts   supply equipment   economic panel   substantive comments   radiological emergency   only places   important drivers   statutory authority   centralize grid   zeroemission vehicles   netzero emissions   exist technologies   tribal departments   metric tons   alternative method   detail findings   moral force   electric markets   research program   primary benefit   second year   wastewate treatment   extreme change   tribal committees   propose changes   action plan   grant fund   several studies   bipartisan committee   several concerns   federal capacity   permit system   technologyneutral standard   retail utilities   robust program   report release   propose preparedness   fund authorization   consumer perspectives   american agriculture   national corridors   national vehicle   new leases   cost calculations   fund initiatives   heighten risk   direct utilities   global leadership   direct pay   climate bank   indian country   resilience standards   exist queues   exist rights   positive voice   technical committee   preindustrial levels30   energy group   healthy hr   conventional fuels   feasible alternatives   seismic hazards   backstop recommendation   estimate benefits   infrastructure deployment   current streams   robust review   steep challenges   water supplies   upfront costs   longterm impacts   deployment technology   pollute waterways   second half   guarantee program   federal flood   great impact   extreme failure   offshore doe   national recommendation   science space   national program   removal technology   global leader   solar property   acidic species   expand role   national standard   generate electricity   solar owners   federal members   utility bills   eminent domain   propose legislation   public participation   lowcost resource   direct lines   solar committees   continue operation   coolant manufacturers   solar communities   transitoriented strategies   authority recommendation   clean investments   solar expansion   plummet wind   act discussion   cool buildings   cultural sites   more parts   destructive wildfires   dieselpowered vehicles   multilateral development   rural energy   epa waiver   expedite protocol   uniform measurement   last months   exist onshore   extend periods   physical infrastructure   deployment technologies   electricity doe   applicable deadlines   additional extensions   short time   advance solutions   isolate communities   generic assurances   power lines   annual health   legislative strategy   secure https   state leadership   carbonfree grid   direct industry   supply chains   energy integration   climaterelated vulnerabilities   high upfront   assistant secretary   vibrant economies   several energy   externalize emissions   national supergrid   financial incentives   netnegative gas   ongoing oversight   solar microgrids193   longterm extension   high temperature   clean legislation   certain percentage   increase use   propose transmission   global climate   mental effects   electrical grid   expect increase   management agencies   marginalize communities   catastrophic events   public interest   decisionmake processes   clean credits   climate mitigation   vast deployment   pandemic policy   next generation   federal projects   variable output   cumulative health   solar equipment   nonpartisan think   lowincome community   national planning   policy environment   clean power   non vehicles   site authority   infrastructure levees   significant threats   historic efficiency   indian policy   gasoline stations237   solar projects   energy deployment   loan guarantees   offshore committees   key definitions   material harm   onsite generation   nuclear waste   crosscut team   tax value   rigorous standards   narrow conditions129   stewardship practices   food systems   transmission capacity   create jobs   nonagricultural uses   interconnection backlogs   rise wildfires   public safety   energy resources   innovative efficiency   manufacture facilities   new sectors   consistent application   renewable resources   low standard   political process   windy conditions   direct funding   local jurisdictions   modern grid   private investment   nonpartisan expertise   vast resources   climate risks   coordinate strategy   climate plan   widespread adoption   benchmark requirements   aviation sector   national origin   wildfire resilience   security threats   hardesttoabate sectors   tribal partners   major areas   tailor approach   cost allocation   deindustrialized areas   generator owners   project release   technical issues   energyintensive industries   nexus considerations   key components   youth activists   resource agencies   broad allocation   clean options   resilient views   reduce recommendation   energywater team   market forces   coral recommendation   new agency   unhoused people   spend recommendation   democratic institutions   submerge testimony   resilient infrastructure   standard resources   electric program   radioactive waste   resiliencebased codes   public analysts   public engagement   climaterelated legislation   doe programs   virgin islands   fixedprice contract   well pads   human health   safe conditions   great certainty   foreign competitors   transparency requirements   certain circumstances   new demand   infrastructure investments   smart climate   largescale weatherization   statewide alliance   rural parts   economic damages   efficient treatment   staff recommendations   blue economy   economic volatility   public input   workforce program   executive action   consistent recommendation   ethical dimension   food insecurity   oil consumption   congressional plan   propose cuts   nuclear recommendation   discrimination policies   different regions   thorough review   light trucks   federal laws   sector groups   premature deaths   methane pollution   24th conference   new purpose   fast act   low value   tribal capability   global innovation   utility proposals   potential recommendation   final report   strategic reserve   drive projects   ambitious targets   sustainable act   executive secretary   purchase goals   frequent inspections   low price   military installations   labor standards   update codes   equity partners   few assumptions   process heat   alreadystretched supplies   proliferation recommendation   rural electrification   inspection cuts   fiscal exposure   subsequent license   smart growth   unmitigated climate   clean future   relevant statutes   military infrastructure   safe water   new passenger   future act180   tactical vehicles   comprehensive action   limit liability   many provisions   scientific integrity   standard efficiency   wwwhydroorgwaterpowerconverting nonpowereddams   future https   battery resources   tribal lands   environmental priorities   good stewards   affordable developments   far extensions   industrial goods   significant consequences   international organization   technology facilities   wind incentives   electric grid   international development   minimum prices   great incorporation   renewable future   distribute systems   grow risk   several barriers   coordinate investments   power heating   fast responses   license renewals   solar resources   high cost   american energy   fercjurisdictional markets   healthrelated needs   financial commitments   statebystate approach   refueling credit   nonrto regions   base approaches   several tools   hybrid resources   overall efficiency   risky areas   environmental protection   act authority   combine heat   federal infrastructure   doe program   total energy   industrial sector   domestic goal   residential projects   defenseless man   strong recommendation   climate crisis   recent data   weight limits   assistance committee   lose workdays   complementary benefits   state regulation   tax incentive   hydroelectric dams   same phase   inspection protocol   performancebased standards   protection agency   general public   nuclear mitigation   legislation release   global levels   reliable information   localize information   force confinement   propose recommendation   successful amendment   regulatory barriers   technical issue   full potential   economic slowdown   competitive fund   propose rulemaking   dirty technologies   critical services   clean sources   tax code   moral duty   estimate deaths   strong standards   wildlife corridors   incremental investments   federal spending   highvalue designation   physical wellbeing   robust plans   lowcost electricity   disaster risks   potential technologies   good predictor   new sales   federal disaster   federal development   reliability organization   community access   permit doe   sustainability program   direct developers   private capital   detrimental effects   offshore recommendation   regional processes   doe office   general matter   national efficiency   many parts   radiological disposal   outdoor training   coronavirusrelated emissions   lowincome farmers   damage wildfires   national certifications   climaterelated threats   certain standards   qualify facilities   onshore wind   overall structure   net emissions17   measurable reductions   diversify rotations   major cuts   clean markets   policy toplines   offshore facility   short recovery   future discussion   grid committee   nuclear power   local development   concrete action   grid program   catastrophic flooding   stakeholder processes   middleclass households   large consumer   subsequent renewal   efficiency targets   clean toplines   economywide decarbonization   integrate plan   business views   pilot program   procurement policies   ongoing relationships   adequate representation   oversight role   advance technologies   great selfdetermination   harbor deadlines   community plans   flood disease   first mw   harden infrastructure   sister earth   comprehensive action11   great toplines   crisis jobs   practice goals   transport treat   foreign goods   offshore incentives   flexible grid   same time   critical transformers   zeroemission electricity   similar challenges   customer demand   ancillary services   chill impact   work people   expose industries   clean transportation   economic sectors   duty vehicles   electricity generation   restoration time   southeast administrations   rail network   regional planning   fund governments   nonprofit cooperatives   energy implementation   exist buildings   solar heating   unique assistance   long period   america act   narrow proposals   national purposes   specific projects   environmental policy   ecological health   national priorities   climate assessment   federal lands   national military   interim sales   renewable projects   major renovations   air quality   solar companies   great support   resilient systems   federal commitment   clean electricity   second part   federal administrations   native villages   hot conditions   climate policy   climate adaptation   adaptation program   climate opportunities   anthropogenic carbon   climatefueled disaster   range seasonality   fund requirements   commercial activity   reduction goal   frequent floods   dislocate energy   cyber threats   adaptation planning   just way   market structure   renewable onfarm   public hearings   development assistance   financial challenges   direct capture   lightduty section   prove way   fair system   pfas amendment   clean resources175   act recommendation   remain parks   localize concerns   infrastructure collaborate   many experts   corporation nerc   low goods   tribe territories   consistent analysis   major challenges   natural resources   oil coal   indian land   electric access   onshore technology   policy path   consumer market   vulnerable individuals   green act   spare transformers   proactive action   decarbonize supply   additional options   thermal energy   online wind   early input   multipronged approach   different challenges   federal credits   competitive funding   unfair subsidies   maximum level   potential impacts   tax relief   chain goals   environmental impacts   offshore development   exist infrastructure   rural communities   ambitious action   unjust recommendation   electric energy   pollution reduction   unify standards   defer maintenance   technology transfer   internetconnected technologies   health capabilities   interestfree loans   comprehensive review   multifamily buildings   nrc processes   wholesale rules   heavy fuels   key elements   local conditions   negative emissions17   methane leaks   qualify section   reliable transmission   supply chain   discussion draft   health departments   immediate benefit   hurricane investments   climate science   daily emissions   large landscapes   offshore transmission   religious response   several states   potential proliferation   climateliterate public   public policy   manufacture jobs   ongoing nerc   resilience gap   new gasoline   reliability concerns   meaningful reductions   federal policy   make vehicles   interconnection study   high value   direct agencies   ambitious goals   grid infrastructure   write input   expose communities   additional projects   solar options   infrastructure consumers   zerocarbon doe   qualify property   future generations   potential power   result technologies   robust policies   regional growth   subsequent ambiguity   subsequent applications   resilient communities   same degree   technology solutions   pollute sources   plan recommendation   renewable security   tremendous growth   such findings   power shutoffs   design basis   active role   average value   congestion study   yearoveryear improvement   myriad challenges   wholesale power   few alternatives   expert recommendations   additional funding   avoid calculations   local departments   agricultural carbon   regulatory jurisdiction   urgent threat   propose projects   act hr   nuclear fuel   asthma attacks   nationwide goal   regional reliability   distribute storage   small utilities   net emissions   critical infrastructure   federal exposure   cut emissions   nontransmission alternatives   legislative hearing   streamline permitting   economic crisis   select hearing   current lines   geologic repository   unavoidable impacts   good way   renewable efficiency   significant potential   lowinterest bonds   adjust income   available vehicle   different choices   hazardous materials   reduction program   downward trend   energy electrification   economic potential   severe storms   tropical hurricanes   publicprivate coordination   electric charging   policy failures   agricultural livelihoods   future effects   national lab   available delivering   emission economywide   plug leaks   net generation   greenhouse gases   multiple members   global progress   national plan   lifecycle emissions   share requirements   first step   solar programs   sensitive species   onbill financing   considerable amounts   rural areas   environmental rights   federal block   relevant committees   firstofakind technologies   ecological biodiversity   american economy   rise costs   most responsibility   transportation sector   onsite energy   nation transition   reasonable assumptions   water systems   energy technologies   flood losses   integrity policies   high standards   entrench interests   nearterm opportunities   improve environment   congressional action11   legislative solution   rate designs   wild places   oftenbroken system   robust codes   unemployment benefits   propose issues   foreign nations   additional benefits   cumulative costs   watercooled technologies   little time   low alternatives   conservation strategy   coastal installations   clean microgrids   energy leadership   holistic assessment   offshore system   super pollutant   costeffective efficiency   large hurricanes   distribute capacity   monthly average   substantial investment   long delays   exist fleet   large network   good jobs   important services   longterm disposal   annual outlook   promote act   global demand   large source   national academies   accessible pathways   remain emissions   robust requirements   financial barriers   reliable investment   cybersecurity plan   wholesale operators   potential models   unemployment system   energy outlook   energy sector   safe vehicles   transmission reliability   investigative functions   market certainty   international community   important action   future work   notable gap   coordinate plan   deployment134 section   tax breaks   key assumptions   environmental statutes   domestic content   financial tools   possible cost   indian development   coastal grid   small businesses   les capacity   independent authorities   flood losses53   community programs   rule preparedness   designate communities   wholesale sale   deep reductions   international stage   full decarbonization   negative justice   offshore projects   performancebased incentives   physical attacks   transmission constraints   community ability   community https   commercial plants   heavy vehicles   small participant   energy credits   regional efforts   substantial reductions   renewable purchase   cornerstone laws   little liability   additional research   stringent committees   small facilities   domestic supply   ultimate task   nuclear fleet   atmospheric climate   substantial costs   numerous challenges   executive summary   extreme flooding   standard organizations   strong codes   safe level   healthrelated impacts   crosscut program   commission status   robust policy   longterm resilience   cuttingedge technology   stormwater problems   western parts   interregional planning   structural mechanics   human crisis   wildfire risks   climaterelated impacts   free electricity   zev standard   new credit   portfolio standard   enormous scale   interconnect system   catastrophic insecurity   thirdparty providers   key challenges   energy use   dangerous impacts   discriminatory recommendation   feasible lines   commercial deployment   periodic basis   consistent crisis   clean incentives   performance standards   intelligent reclosers   bilateral development   federal government   process changes   environmental laws   climaterelated disasters   stakeholder engagement   vmt fee   good position   longerterm extension   plan regions   compress air   primary driver   tax credit   grid planning   aid funds   insular affairs   own electricity   ample supplies   credit value   weak standards   bipartisan briefing   zev sales   renewable standard   corporate disclosure   climaterelated programs   urban tree   demonstration projects   strong protections   national reductions   national capacity   critical equipment   new lines   solar wind   energy policies   clean resilience   similar provision   safe storage   cumulative emissions   advocacy groups   business insider   more lines   telecommunication network   mpg efficiency   resilient finance   severe impacts   clear signs   climaterelated codes   domestic jobs   future section   onshore projects   hard work   geothermal capacity   national efforts   exist centers   doe development   federal investment   select committee   clean technology   local support   public lands   humanitarian organization   widespread benefits   regional injustices   unreasonable recommendation   new energy   small reactors   waste pillar   primary reasons   few solutions   spin-dry conditions   response project   tropical cyclones   exist dams   continue support   lifetime savings   consistent standards   lightduty trucks   natural gas   highincome communities   clean program   scale strategy   marine energy   federal strategy   monitor model   regional organizationindependent   analytic tools   efficiency demand   renewable standards   magnet section   wildfire standards   electric space   total savings   property values   precipitation patterns   local consent   care systems   renewable facilities   technological complexities   rural utilities   labor practices   grid disruptions   reliability standard   individual sources   clean growth   regional initiative   review act   health risks   20year extensions   solar upgrades   urgent call   climate change   smart finance   clean draft   individual baselines   elevate risk   underserved communities   tribal nations   consumer purchase   direct doe   renewable energy50   investment act   forwardlooking projections   massive investments   community agreements   oversight authority   electric grid186   outer shelf   infrastructure decisions   longterm purchase   public vehicle   extreme threats   extreme winds   transportation policies   critical time   congressional intent   project development   environmental benefits   deep work   customer participation   more choice   technical resources   human activities   dedicate funding   systemic supports   common good   technical considerations   workforce opportunities   climate impacts   few resources   fleetwide assessment   coral conservation   continue delivery   direct ferc   worsen impacts   residential owners   environmental review   national goal   various policies   american competitiveness   entrench inequalities   environmental racism   interstate lines   social wellbeing   clean standard   stable investment   economic transition   durable economy   lightduty cars   demand economywide   national policy   presidential action   rise temperatures   cybersecurity risks   few attacks   current order   dynamic ratings   pay option   new opportunities   global inequality   congressional letter   anthropogenic emissions   federal price   legislative climate   large volumes   local opposition   hybrid vehicles   american people   humanitarian efforts   interstate projects   geothermal resources   highprofile examples   regional economies   25d credit   fiscal impacts   future act   reauthorized efficiency   much energy   several projects   comprehensive legislation   climaterelated innovation   high wages   cooperative ways   eastern interconnection   innovative technologies   future costs   compete priorities   change efforts   legislative action   black pollution   subsequent renewals   alternative vehicle   atmospheric concentrations   regional chains   viable opportunities   catastrophic damage   innovation policy   energy standard   power imbalance   federal funding   transmission congestion   sector emissions   legislative committees   independent system   workforce capabilities   distribute resources   new vehicles   energy development   young evangelicals   good practices   land use   transmission planning   healthy environment   fuel efficiency   domestic technologies   continue research   plan models   economywide emissions   food pillar   support activities   coordinate support   site recommendation   national defense   nexus program   social systems   private doe   transmission facilities   economic recovery   public stakeholders   indian lands   commission notice   energy projects   additional policy   regulatory commission   federal goals   treasure lands   affect communities   hard time   exist programs   vulnerable populations   natural solutions   emerge committees   strong institutions   extreme storms   national corridor   gridscale program   strong example   essential needs   economy pillar   modular reactors   independent evaluators   operational sources   convenient options   wildlife habitat   choice act   lowincome access   massive expansion   down recommendation   healthy economy   profitable production   expand deployment   reliable grid   regular session   practical terms   critical partners   high confidence   renewable production   resilient recovery   federal incentive   poor communities   extreme events   operational measures   highroad standards   mandatory markets   significant authority   racial injustices   energy workers   economic opportunities   information service   climate action   scientific expertise   financial need   strong buildings   timely implementation   fossil fuels109   domestic demand   coalfired plants   american workers   legislative response   legislative changes   right structure   environmental pollution   arctic engagement   renewable development   uneven access   systemic injustices   technology pillar   technical support   reliability services   environmental research   wind technologies   key decarbonization   energy costs   code agencies   electric cars   robust standards   increase electrification   interstate facility   clean infrastructure   distribute efficiency   infectious diseases   good health   infrastructure choices   clear goal   key findings   coastal areas   renewable growth   solid foundation   standard standards   dioxide concentrations   certain conditions129   preventative power   scientific duty   unique chance   significant driver   regulate markets   beneficial opportunities   detail description   longstanding tenets   severe weather215   solar pv   onsite resources   competitive program   large emitter   vulnerable communities   energy storage   solar act   environmental changes   hard place   great instances   online system   reconstruction investments   economy act   scientific assistance   final rule   public utility   government force   consentbased siting   regional collaboration   global security   tribal government   integration group   necessary analysis   international missions   grow demand   vehicle credit   interconnection queues   exist recommendation   bedeviling blackouts   climaterelated work   future draft   regional impacts   accompany credit   federal notice   localize grid   radical departure   promise source   local officials   lengthy process   electric substations   organize markets   recovery opportunities   different stage   development permitting   propose rate   begin farmers   possible emissions   infrastructure property   urgent action   coastal resilience   lowincome families   financial resources   past inaction   energy technology   extreme floods   public confidence   tribal leadership   extreme heat   new spending   final reg   broad backlogs   natural infrastructure   exist hydropower   fast reductions   vulnerable plants   similar projects   broadly institutions   regional consequences   meaningful engagement   distribute system   valuable climate   manufacture infrastructure   climate threats   major components   renewable energy   ambitious initiatives   costeffective term   zerocarbon generation   energywater considerations   loan program   environmental stewardship   variableoutput sources   revolve grants   mental health   mental capabilities   global action   lead cause   affordable housing   competitive basis   rigorous assessment   risk information   innovative solutions   first plan   ongoing basis   use committees   highroad practices   future storms   future president   zerocarbon electricity   discriminatory rates   comptroller general   ambitious use   change opportunities   marine resources   local districts   available funding   gridscale storage   national panel   peaker plants   skill workforce   particulate matter   wholesale governance   emergency planning   file system   backup power   existential threats   risk recommendation   public system   master plan   tribal governments   equitable section   foreign affairs   aging collaborate   equity concerns   energy policy   significant upscaling   build reuse   total consumption   intervenor funding   propose project   possible experts   rise levels   urban confidence   loan funds   electric cooperatives   vehicle committee   future change   inland bases   available program   ethnic tension   exist authorities   such rules   monthly value   atomic power   stateowned buildings   federal support   demonstration program   desalination hub   significant barriers   electricity providers   wildfire plans   renewable integration   strategic report   grid impacts   site block   consumer credits   specific proposals   technical assistance   strengthen program   green deal   alternative credit   support compliance   permanufacturer cap   distribute generation   cooperative federalism   current law   national parks   new opportunity   more funding   infectious disease   cumulative effects   market rules   sale targets   interfaith power   new generation   resilience investments   high percentage   economic losses   high probability   program section   strong driver   domestic objectives   racial equality   little credits   efficiency improvements   federal reserves   industry s   environmental injustices   competitive zones   weather events   resilient panels   issue incentives   energy generation   marine environment   atmospheric administration   storage act   wildfire information   neutral economy   own buyers   ga pollution   propose rule   longterm funding   important basis   resilient economy   clean policies   clean resources   safety hazards   consumerfacing resources   science agencies   power outages   renewable ptc   seismic risks   american homes   heavy downpours   key role   transmission corridors   natural disasters   inadequate consultation   appropriate consultation   wind property   harmful emissions   key reforms   continue leadership   statelevel policies   exist pipelines   social cost   development supply   tribal sovereignty   natural climate   stringent requirements   voluntary protocol   use compliance   engage leaders   migrant communities   blue carbon   program funds   nexus support   energy efficiency   operate plants   physical security   color communities   fine pollution   more zeroemissions   focus innovation   critical sinks   state authority   systematic change   house resolution   clean act   intergovernmental panel   natural disaster   netzero pollution   local capacities   energy retrofits   electricity sector   national response   extreme report   equitable taxation   renewable equipment   electricity future   high penetrations   southwest regions   national labs   tribal initiatives   social resilience   net act   seam study   tangible benefits   current consumers   nexus work   food system   voluntary program   family businesses   online policies   high earthquake   small energy   multiple sources   broad suite   environmental action   ambitious standards   residential buildings   efficient use   geographic areas   good act   http wwweiagovoutlooksaeotables_refphp   solar energy   federal minimum   human systems   essential technology   adaptive capacities   renewable electricity   public emergencies   economic benefits   block help   clean water   electricity prices   black colleges   moral obligation   sale standard   grow area   certain projects   significant change   wide areas   consumercentric model   great resources   formal request   nuclear industry   ga siting   offshore areas   national missions   transmission facility   energy poverty   systemic inequalities   ga standards   price cap   nonbinding goal   garret graves   clean nations   heavy rainfall   risk mitigation   radioactive materials   grid technologies   political institutions   environmental hazards   electric utilities   standard committee   base economy   regulatory design   expansive workforce   mitigation grants   energyrelated dioxide   minimum requirements   real system   comprehensive response   comprehensive set   new program   resource adequacy   effective solutions   work group   renewable generation   solar power   small projects   wind energy   financial support   policy goals   advance systems   unemployment analysis   wwwenergygoveapowermarketing administrations   significant representation   private sector   uninsured losses   nonpowered nonpowereddams   broad portfolio   site process   national act   share mobilization   battery storage   key technologies   geothermal heat   actionable codes   civil penalties   framework agreement   direct option   efficient transportation   quantifiable benchmarks   nexus challenges   solar alliance   transmission policy   economic development   elaborate infrastructure   new facilities   additional recommendations   more storms   renewable address   solar production   recur disasters   green climate   federal agency   highlight concerns   sustain commitment   stringent standards   industrial decarbonization   rapid changes   rural ways   clean procurement   advance vehicles   adverse health   http wwwicfcominsightsenergyrenewableenergynextgeneration   new transmission   such recommendation   effective resources   electrical economy   power plants   global charge   lightduty fleet   global change   legal challenges   distribute providers   diverse interests   clean technologies   site presentation   unprecedented reductions   distribute communities   occupational safety   new locations   leaky infrastructure   overburden communities   federal code   congressional action   electricity supply   broadband networks   technological innovation   necessary infrastructure   potential costs   first conference   grant funding   electric infrastructure   clean efficiency   black communities   dioxide emissions   good products   benefit agreements   nearterm reductions   standard committees   ambitious measures   own vehicles   infrastructure policy   longrange strategy   prevail requirements   geothermal energy   national strategies   many cases   electric system   annual rate   climate pollution   float foundations   clean vehicle   nearterm deployment   damage components   good benefits   utility poles   extend length   exist facilities   spend act   actionable information   proper maintenance   safety oversight   several investments   essential services   public services   low rates   exist law   rise demand   defense plans   federal analysis   indigenous communities   energy innovation   bold action   renewable pathways   important habitat   great say   electric utility   reference point   yearoveryear reduction   management standards   social strife   federal agencies   regional partnerships   gasfired plants   same commitment   tribal development   meaningful participation   drive innovation   credit access   share sense   total emissions   energywater program   landgrant universities   ga emissions   hybrid systems   prosperous economy   high costs   global warming   co2 emissions   selfscheduled resources   local workforce   opportunity board   carbon price   nuclear plants   first vehicles   future recommendation   assistance program   federal funds   eastern generation   use program   policy recommendations   state policies   standard requirements   lowincome workers   charge stations   alternative payments   american study   rise number   business models   vehicle cap   provide opportunities   interstate highways   short term   geothermal committees   ambitious goal   justice community   emission reductions   hazardous waste   project permitting   federal rules   result overpayment   interest corridors   electric bills198   technology recommendation   species loss   future rise   high burdens   qualify energy   national strategy   coastal cities   follow blocks   21st century   appropriate value   voluntary agreementinprinciple   federal policies   new standards   crucial services   frequent events   national security   broad areas   federal legislation   solar workforce   tribal colleges   dry conditions   strong economy   bulk grids   down committees   more funds   consistent goals   transmission owners   report provision   high future   climate resiliency   islamic relief   green energy   allocation methodology   strong foundation
Actions:   strain relationships   implement suite   govern meetings   offer programs   spend more   create generation   evaluate ntas144   remedy impacts   increase stresses   undergo retrofits   provide members   lay pathways   honor responsibility   establish service   take members   employ commitment   support action   deliver recommendations   reduce efficiency   overcome failures   retain authority   help families   manage exchange   discourage investments   develop transmission   flywheel capacitors   introduce sunshine   wash airplanes   identify path   end taxation   support them   asses reliability   charge gap   fund vulnerability   leverage investments   achieve rate   power territories   meet challenges   provide ferc   manage resources   buy requirements   define energy   reduce selfscheduling   update act   nonprofit ways   evaluate effectiveness   make choices   integrate protections   power economy   incentivize discussion   address concerns   stop investment   support supergrid   offer hr   expand development   protect habitat   use market   build crossstate   expand credits   afford installation   review courts   advise what   invent policy   improve technologies   incentivize states   adopt resolution   review barriers   quantify innovation   reach communities   determine value   achieve mindset   limit length   afford insurance   degrade disease   suffer impacts   implement some   create corridors   remove doublecounting   observe model   safeguard infrastructure   weaken oversight   create views   rank rla   involve costs   authorize director   pursue fuels   relate risk   distribute electrification   include pilot   encourage deployment   discuss challenges   conduct projects   organize conference   use point   complete part   offer voice   deploy information   update goals   integrate technologies   set requirements   employ strategies   provide continuity   facilitate transition   bring studies   enact act   benefit 288   include territories   build build   storage standard   purchase vehicle   integrate considerations   reflect values   evaluate risks   leverage investment   reimagine economy   generate waste   maximize tonko   limit participation   tackle that   access draft   strengthen conclusion   address ways   reduce exposure   cost guidebook   advance resilience   establish group   face competition   review groups   facilitate development   incorporate adaptation   deploy vehicles   cut 300   decarbonize storage   preserve farmland   contain minimum   provide committee   unveil panels   introduce companion   expand 80   benefit coal   improve economy   complement work   increase glaciers   make gasoline   face probability   maintain grid   strengthen capabilities   deploy pathways   use systems   represent 18   use 25   overwhelm levees   pursue policies   30c credit   manage wildfire   aim j   incorporate perspectives   protect workers   develop protocol   increase generation   recreate5 community   examine effectiveness   exceed energy   reduce impacts   connect building   reduce ability   establish rates   cite matthew   deploy energy   provide americans   decline 17   provide set   rebuild infrastructure   direct ferc   make findings   use credit   detail some   transform fleet   stop deforestation   achieve electricity   restore lands   spur technology   treat water   limit application   reduce use   distribute funds   incentivizes conference   prioritize climate   support infrastructure   bolster capacity   worsen demands   lose jobs   afford opportunity   solve solutions   drink facilities   introduce expansion   impose that   raise concerns   match requirements   provide certainty   implement strategies   maintain responsiveness   create 366   affect impacts   diversify institutions   increase bills   eliminate account   protect environment   leave communities   build line   hit farmers   defray costs   prioritize investments   increase itc   reach economywide   phase itc   heat impacts   leave initiatives   treat credit   expand financing   introduce energy   build change   capture potential   keep rates   spur investment   conduct activities   provide households   pay wages   direct academies   fix mistakes   deliver changes   concentrate heating   engage representatives   build demand   use funds   mitigation measures   create imbalance   find funding   approve renewal   inform consumers   create millions   borrow authorities   deploy technology   maximize potential   require organization   expand growth   address states   prioritize investing   restore forests   bridge gap   support generation   harm environment   require priorities   internalize costs   approve project   support departments   make recommendations   analyze opportunities   carry volumes   leaf plants   use literature   increase reliability   secure workers   frustrate policies   charge deployment   require regions   expand grid   offer array   ignite vegetation   facilitate sharing   create board   outline principles   achieve rating   permit lines   exceed report   need attention   secure resources   drive growth   require ferc   hold briefing   achieve grid   come policies   enter contract   low concentrations   reach c   limit leasing   complement output   direct nrc   expose risks   deploy use   integrate systems   remove exemptions   improve recommendation   play role   include section   put people   maximize implementation   raise cap   perform allocation   inform development   convert nonpowereddams   connect regions   wash bridges   evaluate projects   address tribes   develop solutions   maintain review   direct dod   prevent flooding   mitigate promise   estimate interruption   surge downpours   include increases   release draft   wait concentrations   http infrastructureenergyefficiencywaterutilities   harden infrastructure   exceed targets   expedite electrification   finalize revocation   develop scenarios   ensure safety   receive support   express concerns   make commitment   direct general   save money   expedite deployment   introduce evs   waive preemption   preview recommendations   enact suite   ignore recommendations   avoid outcomes   make improvements   set goals   harness power   demonstrate technologies   apply credit   own homes   afford vehicles   eliminate waste   harm pollution   require investment   replace plants   coordinate toplines   avert pollution   slow growth   retreat seas   include technology   reach emissions   buy electric   update cost   include targets   lower use   prioritize solutions   offer proposals   force evacuations   reflect science   improve planning   squeeze pollution   develop systems   use strategies   generate capacities   enable building   offer opportunity   achieve reduction   generate savings   expand coverage   produce jobs   impose moratorium   succeed issue   help businesses   asses performance   direct licensees   flood events   leave millions   urge secretary   achieve pollution   cause c   direct regulators   shape future   nonenduring locations   establish program   require plants   resolve issues   cover number   invalidate study   enable tva   identify alternatives   cost reductions   create rules   need analysis   continue vows   guide decisionmaking   achieve sector   take years   establish itself   harm fisheries   procure electricity   enable condition   address opportunity   support approaches   eliminate requirements   change https   cut emissions   reduce 390   address issues   guarantee reductions   emphasize assessment   prevent deaths   set rules   replace collaborate   create committee   reduce invest   expand s   seek partners   constitute cause   establish targets   develop strategy   advance justice   join forces   build 32   announce goals   expand deployment   cut invest   drive compliance   harm climate   ensure delivery   expand networks   reflect value   pose risks   repair legacy   use 157   provide pathway   support veterans   preempt regulation   reauthorize funding   reauthorizes funding   knock 80   introduce bills   pair them   launch partnership   help populations   include villages   replace poles   ensure communities   knock lines   trade credits   repeal breaks   set groundwork   enable country   avert consequences   upgrade system   make appendix   take debt   support development   accelerate financing   implement strategy   make deployment   afford opportunities   ensure operations   enhance supply   enhance deployment   decommission plants   procure percentage   accommodate increased   enhance protections   propel economy   rejoin agreement   include requirements   conduct assessment   use section   study implications   prepare leaks   face challenges   slow pace   fix act   protect species   adopt measures   urge roundtable   solve jobs   compromise reliability   identify vulnerabilities   solve opportunities   coordinate page   expand projects   generate onsite   decarbonize transportation   hold hearings   draw carbon   mate agencies   direct agencies   increase recommendation   evaluate processes   fueling equipment   offer act   cost reactors   retrofit conduits   rebuild s   strengthen chains   increase production   negotiate conditions   modele pathways   include coating   maximize capabilities   prepare network   describe goals   require reduction   deploy suite   debate hr   limit exposure   restore risks   govern markets   provide discounts   incentivize development   limit implementation   fulfill requirements   require disclosure   achieve access   present challenges   maintain standards   address urgency   reestablish congress   select analysts   escalate costs   cause conditions   cause billion   use pillar   trade policy   reauthorize development   protect vulnerable   expedite transfer   reward need   introduce certainty   offer alternatives   defray cost   achieve benefits   extend deadlines   provide standards   offer recommendations   apply agencies   commit funding   include areas   eliminate 285   ensure use   constitute consultation   assist communities   provide loans   establish facilities   offer credit   rule part   affect missions   approve proposals   grow chain   evaluate alternatives   use models   eliminate support   delay release   worsen country   provide guarantees   permit integration   minimize impacts   establish rules   aggregate ders   accelerate transition   reflect framers   reduce protections   set targets   increase support   resolve barriers   avoid deaths   plan element   expand programs   provide governments   discuss impact   build electrification   adopt designs   reauthorize demonstration   exceed limits   understand system   require investments   harden poles   broaden inequities   expand owners   provide example   facilitate grid   require electricity   support deployment   encourage cities   deliver energy   reflect concerns   fulfill policies   accelerate decarbonization   span interconnections   construct lines   receive priority   propose rule   negotiate agreementinprinciple   provide investment   warm planet64   require standards   take actions   felt costs   receive electricity   site repository   asses projects   prevent release   asses progress   follow staff   employ tools   transform energy   mitigate offer   increase these   distribute equipment   raise bills   meet percentage   set own   create system   restore leadership   create inefficiencies   amend purpa   hit high   expand initiative   need upgrade   reduce toplines   confront crisis   claim benefits   prohibit leasing   have chance   include which   launch sectors   enable emissions   sell them   seek renewals   reduce risk   develop generation   install pv   releasesrepsmikelevinandykimanddorismatsuileadcongressionalletteropposing storage   reach netzero   phase ptc   establish panel   require buildings   generate energy   remove dioxide   conserve landscapes   charge stations238   help communities   generate electricity   modele recommendations   receive governments   review hundreds   diversify generation   protect infrastructure   advance solutions   shift capital   slow deployment   develop facilities   withstand losses   hit cap   include electrification   navigate system   analyze legislation   alleviate incentives   withstand storms   disrupt agencies   examine queues   finalize standards   reduce energy   develop manufacture   give choice   put country   transform lands   decarbonize sector   withstand weather215   encourage adoption   draft study   phase section   deploy 276   establish plan   support analysis   call rule   increase values   integrate levels   expand definition   standards222 states   purchase electricity   ensure confidence   offer services   transmit electricity   address effects   require planning   set outlook   resolve many   consider investing   analyze impacts   develop set   go allin   accelerate learning   set cap   mitigate transition   strengthen policy   give draft   improve health   create bank   end perpetuation   revise code   model recommendations   sustain platforms   continue unabated62   operate dams   pose hazards   compare severity   require secretary   boost development   announce hub   facilitate purchase   address congress   qualify hydropower   improve program   expand assistance   improve review   incorporate amendment   eliminate cap   refueling bill   harness onshore   introduce infrastructure   incentivize reuse   offer gao19157sp   choose value   eliminate barriers   center justice   choose recommendation   threaten ecosystems   affect institute   maintain minimum   reflect amendments   combat 9   embed mitigation   demonstrate importance   use energy   inform operations   issue waivers   support systems   water part   restore protections   reduce amount   train transport   include costs   implement partnerships   expand department   build innovation   leave workers   reinvigorate sector   reap benefits   phase flaring   bear responsibility   lead states   eliminate subsidies   slow permitting   include provision82   establish flood   influence extent   build facility   provide cash   implement portfolio   amend interests   include funding   draft report   harness innovation   seek assistance   provide grants   review prices   finance project   provide communities   land netemitter   attain environment   direct government   employ practices   express support   mobilize masse   transform industry   provide payments   promote generation   depopulate communities   stress systems   bend curve   enable reductions   meet goals   generate benefits   increase resilience   require providers   dissipate impacts   qualify association   reauthorize activities   cause breakdown   provide reductions   thaw permafrost   support communities   fishery city   reduce consumption   blow deal   add complexity   need system   balance variability   affect 37   provide relief   put americans   reach decisions   minimize recommendation   task nerc   accommodate scenario   assemble committee   restore delivery   cut power   fueling conflicts   benefit workers   enable states   protect shorelines   reduce capacity   defend interests   hit systems   satisfy demand   protect integrity   quantify vehicle   make buildings   reauthorizes sections   create standard   distribute resources   provide utilities   consider emissions   represent communities   expand initiatives   improve community   modernize infrastructure   impose requirements   set invest   asses costs   introduce hr   provide climate   operate impacts   purchase committee   spur congress   develop initiatives   provide https   cover technologies   encourage policies   improve quality   finalize rulemaking   meet requirement   define level   create initiative   solicit input   require legislation   reduce losses53   create markets   ensure vehicles   manage risks   http wwwacqosdmileieiefep_renewable_energyhtml   uncover risks   produce solution   cost volatility   require reductions   set prices   put price   strengthen enforcement   allocate funds   address obligation   store carbon   ramp renewables   break barriers   discover access   inspect measure   reduce cost   help protect   improve efficiency   implement shutoffs   provide tribes   provide credit   bring wind   advance proposals   stabilize climate67   fueling block   support decisionmaking   find rates   jumpstart industry   create chains   use codes   maximize efficiency   facilitate transfer   drive trend   augment capability   resolve backlogs   enable decarbonization   develop release   pass bills   reclaim wells   capture carbon   strengthen program   maximize deployment   support stages   affect rates   set committee   increase risk   create environment   facilitate partnerships   combat pillar   serve 185   manufacture vehicles   detect problems   issue declaration   address crisis   adapt definition   lead generation   tiered incentives   increase choice   turn tide   rank graves   incentivize purchase   change opportunities   achieve goal   strengthen institutions   lead efforts   adopt rules   see electrification   illustrate type   face barriers   reach goals   strengthen planning   maintain lines   tap congress   expand options   accept waste   provide technology   allow participation   produce energy   extend credits   ensure development   facilitate transportation   enhance sequestration   provide habitat   procure services   ensure collaboration   lead us   use electricity   tackle threat   authorize ferc   set goal   improve capacity   improve maintenance   experience community   http wwweiagovelectricitydatabrowser   underscore need   support efforts   create team   solicit expertise   exceed average   include assessment   title innovation   sign release   spur deployment   develop strategies   demonstrate engagement   increase investment   exceed goal   amend recommendation   deploy tides   develop tools   direct agency   upgrade homes   offset use   threaten communities   hamper response   include grants   project draft   revive office   facilitate expansion   have opportunity   asses models   allocate efficiency   install stations   result path   use levels   announce agreement   exacerbate trends   realize futures   implement process   implement price   degrade air   involve gas   review applications   upgrade substation187   encourage section   largescale shutoffs   review reliability   improve incentives   require deployment   require dod   identify communities   investigate development   take steps   ensure engagement   need support   address challenges   emphasize importance   accelerate innovation   amend act   pass legislation   harness heat   protect farmland   equal scale   include reauthorization   respect mizan   experience instances   direct dol   extend life   light response   boost resilience   mitigate impacts   facilitate permitting   exploit justice   exceed worst   transit city   solve crisis   electrify end   require suppliers   increase section   rebuild economy   require agencies   update notice   encourage government   expand competition   experience events   develop energy   install gw   harmonize processes   ensure manufacturing   encourage agencies   impact threats   respect laws   end policy   expand class   remove roadblocks   incorporate considerations   build grid   reduce costs   include benchmarks   modernize network   increase capacity   expand manufacturing   devastate rico   deliver electricity   promote committee   maintain recommendation   give authority   provide 82   cause earth   identify studies   manage exchanges   avert impacts   find way   include plan   build congress   include provision   complete review   develop project   reduce poverty   address insecurity   deploy alternatives   address threats   build resilience   sell vehicles   model reductions   command us   take course   implement them   cost 35000   spend fuel   incorporate standards   amend section   use tool   prepare communities   set sector   make lands   threaten infrastructure   establish partnership   provide funding   lay framework   develop standards   climaterelated events39   offer section   revitalize communities   match ambition   provide jobs   develop technologies   facilitate access   develop plan   incorporate energy   direct president   expand program   designate corridors   apply approaches   travele fee   limit warming   publish challenges   restore function   deliver doe   adopt s   sign act   reauthorize program   experience health   improve operation   set stage   establish standard   prevent projects   upgrade facilities   phase it   introduce investment   ensure rates   perpetuate racism71   serve half   need it   evaluate benefits   enable agencies   disadvantage decision   manage variability   increase purchase   exacerbate inequalities   benefit support   improve committees   carry consequences   fueling infrastructure   increase investments   require technologies   sell electricity   tackle sectors   experience benefits   ensure consideration   include provisions   acknowledgement appendices   increase authorization   reorganize doe   facilitate action   release report   adopt strategies   foster innovation   develop information   provide option   help plants   outweigh costs   direct office   facilitate supply   face threats   goodpaying jobs   bear change   provide water   direct doe   lay groundwork   set standards   establish reserve   offer developers   deliver assistance   reduce reliance   record planet   cut justice   protect 30   grant permission   add which   inform standards   lend capital   cut resilience   create future   amend 111d   receive credit   allocate costs   transform 16   pass bill   reach electricity   reduce power   require assistance   expand adoption   ensure industries   establish goal   create opportunities   manage use   deploy resources   level field   reduce soot   plague communities   pas standard   prioritize infrastructure   outline work   expand it   invest funds   fund doe   accelerate deployment   urge committee   use investments   improve use   oppose cuts   aging reactor   change destruction   authorize reduction   burden communities   deploy technologies   withhold approval   purchase products   disclose protect   prioritize interests   use financing   achieve congress   neglect parts   procure energy   take approach   reinv savings   make assumptions   lose income   deny project   expand eligibility   bring resources   trigger recommendation   distribute technologies   develop proposals   integrate strategies   encourage allocation   address problems   explore opportunities   introduce incentives   update rules   extend credit   shift assets   abandon wells   prepare report   asses value   prioritize proposals   use authority   highvalue assets   update regulations   support jobs   integrate percentage   prioritize replacement   urge congress   achieve emissions17   describe value   ask questions   enact standard   issue encyclical   ensure reliability   satisfy requirements   approve bill   direct them   fund funds   leverage policies   improve canopy   resolve risks   deliver benefits   complement suite   receive payment   increase number   face exposure   consider changes   set cycles   increase efficiency   mitigate outages   expand itc   require states   advance priorities   incentivize farmers   study need   establish requirements   build sector   drive deployment   claim benefit   move recommendation   achieve sales   follow practices   address scientists   may analysis   provide electricity   ensure areas   lay hundreds   include siting   take decades   analyze implications   maintain program   adopt practices   disrupt patterns   strengthen science   inform decisions   accelerate recovery   meet needs   eliminate breaks   preserve authority   connect gw   align code   achieve generation   introduce opportunities   present challenge   require confidence   energyrelated emissions   create programs   include demand   meet goal   propose rules   direct usda   avoid trillion   exclude sources   provide power   establish incentives   achieve sustainability   increase use   enable development   drop post   expand access   achieve emissions   enhance coordination   develop solution   overcome barriers   build capabilities   facilitate incorporation   assign costs   develop models   face hazards   disclose emissions   require coordination   act purpa   reauthorize efficiency   enact legislation   use bonds   charge consumers   strengthen justice   prioritize projects   create credits   build agencies   meet demand   leaf tribes   face people   cut 197   provide secureand   lead country   add hr   support goals   perform assessment   authorize provision   divide cities   require action   support participation   implement rules   alleviate constraints   favor resources   limit ability   exceed progress   strengthen housing   rend homes   provide method   develop efficiency   increase kw   cut pollution   build emission   increase inspections   invest billion   develop opportunities   target assistance   detail one   releasesrepsmikelevinandykimanddorismatsuileadcongressionalletteropposing union   affect communities   expand demonstration   lack representation   identify barriers   suffer damage   implement solutions   http wwwjewishclimateorgmission   represent storage   develop recommendation   operate presentation   enjoy degree   increase likelihood   include participation   make 20   perform benchmarking   deploy projects   establish justice   cut 104   withdraw states   incentivize investments   increase demand   garner support   conserve lift   reinvigorate manufacturing   enhance enjoyment   conduct analysis   require commissions   protect places   drive emissions   lead charge   flood risk   reduce vulnerability   lift act   travel distances   develop path   require volumes   advance efforts   obtain permits   largescale events   receive funding   review application   deliver billion   prepare networks   produce reclosers   reduce economywide   submit application   increase severity   respect contributions   direct tva   propose standard   withstand interruptions   protect conserve   hardworking americans   withdraw cities   develop states   develop infrastructure   review rules   identify recommendations   deliver projections   help states   emphasize benefits   continue transition   smogforming pollution   evaluate methodologies   adapt operate   open door   total tens   generate 10   reauthorize office   develop deploying   receive developers   regulate isorto   coordinate scale   authorize construction   incorporate bill   introduce draft   satisfy imperative   coordinate plans   address causes   control recommendation   establish policy   enhance resilience   establish force   provide assistance   access information   travele lcfs   mitigate opposition   reduce risks   demand response   offer option   lead letter   help release   demand amounts   build construction   lead mikelevinhousegovmediapress   reward innovation   achieve reductions   introduce engagement   establish efficiency   bury lines   block policies   outline recommendations   asses impacts   ensure resilience   incarcerate persons   reflect information   create program   build hr   recommit initiative   hit targets   review interests   trigger authority   require construction   reduce drivers   help dworkin   create mechanism   pas legislation   include dfl   encourage electrification   streamline process   require doe   deliver services   adopt codes   solve plan   practice use   value voices   enable networks   create thousands   express concern   clarify regulations   cut 113   bring energy   protect science   expand incentives   incorporate efficiency   minimize risks   include approach   provide firms   provide property   direct epa   modernize wwwhydroorgwaterpowermodernizing   enhance leadership   protect communities   achieve potential   lead response   provide resources   drive 214   end bloomberg   wave loss   address bill   restore spaces   involve siting   authorize doe   incorporate needs   build 31   allow recovery   preempt initiatives   decrease voltage   explain initiative   provide dimension   designate areas   maximize reductions   use rights   leave gap   use trading   make communities   update mission   expand funding   enhance safety   analyze emissions   capture benefits   incentivize improvements   address flooding   build substations   present opportunity   need planning   introduce wind   mean space   take advantage   reel pandemic   analyze onshore   signal maturation   reduce gases   include flexibilities   withstand impacts   change patterns   reopen rulemaking   reveal themselves   create america   follow standards   enable deployment   establish assistance   spur generation   calculate costs   authorize it   reach decision   hold meetings   carry weight   asses complexities   cause outages   allow taxpayers   avoid congestion   meet use   authorize wapa   generate 80   offer businesses   empower workers   build cleaner   develop plans   prioritize investment   develop zones   treat things   coordinate operations174   develop report   maintain requirements   enable access   bolster competitiveness   coordinate that   receive credits   accelerate pledge   require commitment   farreaching transitions   create jobs   project costs   develop adaptation   preserve ptc   use policy   pump treat   support health   propose preparedness   smooth demand   store it   guard department   promote projects   finalize rule   determine impact   deploy ders   halt work   restore ecosystems   fund priorities   address seismic   achieve netzero   lead amendment   survive crisis   enforce committee   flatten use   detect disruptions   reduce pollution   create dialogue   serve needs   http administrations   follow suit   improve operations   plummet wind   make investments   authorize office   approve extensions   solve climate   authorize agencies   change effects   introduce access   upgrade infrastructure   increase response   prioritize communities   implement subset   build economy   charge credit   save electricity   reduce 371   represent infrastructure   access status   develop methodology   reflect principles   introduce s   learn work   support building   qualify systems   drive costs   improve governance   license reactors   expand maintain   change report   protect health   remove capability   attain reductions   establish deadlines   include summary   extend expanding   restore grasslands   provide floor   restore systems   create resilient   provide guidance   reveal decisions   reject rules   break economics   modernize https   outline policies   establish board   support committees   save billion138   suppress vote   site congress   weaken planning   consider investment   reduce losses   address impacts   expand capacity   rebuild industry   include generators   create backbone   strengthen policies   http databaseaceeeorgstateenergyefficiencyresourcestandards   provide financing   build policy   purchase power   develop program   assess resilience   deploy cars   reverse decades   use phase   develop resources   consider factors   warm agencies   contain recommendations   frustrate energy   tackle change   provide services   strengthen systems   incorporate cost   boost justice   need safeguards   include owners   improve engagement   retool expand   flood facility   use resources   build pillar   outline plan   provide evidence   modernize markets   require consideration   accelerate https   site lines   require utilities   enjoy exemptions   include perpetuation   provide heating   support progress   carry world   develop policies   reach mw   save trillion   eliminate leaks   solve buildings   avoid impacts   regulate governance161   provide facilities   split authority   bear trillion   establish committees   represent dtx   establish change   moderate increase   avoid need   build capacities   focus attention   need electricitypolicycom   enact incentive   establish measurement   retool facilities   transmit amounts   reduce congestion   improve benefits   upend livelihoods   foster inclusion   allocate tribes   upgrade plans   support policies   modernize program   outline priorities   conduct rulemaking   heat waves   create reserves   exacerbate injustices   introduce act   meet standards   provide heat   touch part   require report   strand assets69   maintain credit   inspect resources   tackle leaders   respect nature   reach million79   protect reefs   connect neighborhoods   cut infrastructure   superconducting section   address risks   build infrastructure   improve calculations   mitigate consequences   fueling vehicles   experience waves   benefit those   achieve economy   provide roadmap   implement part   benefit nation   achieve 100   take place   erode trust   choose pay   reduce pollution78   compound solutions   reauthorize s   coordinate storage   require removal   manage 313   reauthorize sections   take action   authorize funding   enact policies   exacerbate sources   amplify threats   adopt protocol   adopt emissions   interconnect generators   prioritize monuments   adopt standards   provide extension   revoke waiver   start program   support collaboration   capture methane   threaten withdrawal157   close exemptions   employ standards   reevaluate hazards   achieve goals   correct failure   develop projects   require supplies   sustain support   boost funding   promote development   accelerate future   promote resilience   expand transmission   drive demand   methane pollutant   use authorities   build lines   correct failures   impact reliability   tackle crisis   translate attacks   modernize section   undermine leadership   survive insider   increase procurement   enable them   improve ability   clean vehicles   maintain congress   inform providers   eliminate emissions   serve communities   reduce emissions   help transition   use technologies   provide harbor   pair price   affect problems   http relief   create finance   announce efficiency   make changes   build america   issue assessment   include focus   remove barriers   deploy transformers   use storage   extend itc   expand portfolio   alleviate impacts   drive america   direct offices   direct committee   maximize use   follow intent   broaden participation   focus morton   lead world   achieve energy   review processes   use solutions   create credit   identify benefits   deliver reductions   conduct planning   affect operations   provide incentives   conduct review   generate section   deliver jobs   encourage investment   provide savings   threaten committee   operate bill   allocate generators   exceed panel   promote decarbonization   ensure access   ensure adequacy   identify opportunities   affect seasonality   address resolution   reflect services   help site   send letter   overcome risks   address change   trigger disasters   expand 237   provide territories   claim lives   access capital   protect property   represent 68   build initiatives   pursue solution   benefit communities   mitigate s   implement projects   establish standards   accommodate demand210   provide consistency   include exposure   understand impacts   create divide   lift communities   outline goal   increase need   select democrats   look assessment   rend increases   respect leadership   create roadmap   integrate resources   direct department   create demand   advocate activists   allow eligibility   prioritize lands   advance policies   provide benefits   target invest   pas draft   align program   confront threats   clean energy   recommend suite   value workers   increase credit   target women   require transition   exploit opportunities   lack policies   reduce improvement   provide support   strengthen ability   lie foundation   propose incentives   provide rebates   introduce resiliency   address resilience   require science   need information   tie funding   increase effectiveness   exercise authority   host capacity   design goal   export toplines   promulgate standards   create itc   pas extension   affect health   strengthen resilience   issue order   provide leadership   provide community   reduce technologies   adopt one   spend billion   reform programs   build code   build capacity   increase funding   drive decarbonization   establish procedures   relieve crisis   reduce enhance   provide recommendations   complement standards   facilitate integration   require generation   introduce legislation   science health   avoid changes   establish goals   complete analysis   develop recommendations   provide ceiling   ramp generation   expand protections   create crisis   set country   extend ptc   direct commission   organize union   cost smrs   align standards   prepare systems   face impacts   pay attention   review rates   regulate emissions   extend section   update basis   improve resilience   establish process   award grants   restore ocean   eliminate economywide   enable 253   increase vigilance   quantify emissions   cut 200   improve implementation   maximize benefit   accompany policies   ensure field   expand efficiency   urge action   provide solution   establish fund   save lives   slash emissions   detect leaks   improve queues   spur manufacturing   deploy solutions   use materials   increase emergencies   expose regions   build market   improve preparedness   focus page   expand support   reduce waste

Other Attributes

This section lists the details about pathway-specific attributes.